Table 2

Antimicrobial peptides used in this study

PeptideClassChargeAmino acid sequenceSecondary structureTissue sourceProposed mechanism of actionReference
ProtaminePolyamine+21PRRRRSSSRPIRRRRPRRASRRRRRRGGRRRRLinear/extendedReproductive tissuesUnknown for fungi
Rational peptide 1 (RP-1)Synthetic+8ALYKKFKKKLLKSLKRLGα-HelixModeled upon PF-4 α-helicesPerturbation of cell membrane and energeticsCurrent study
Human β-defensin 2 (hBD-2)β-Defensin+6GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPβ-Hairpin/helixEpidermis, mucosaPerturbation of cell membrane, cell wall, and energetics14
Human neutrophil protein 1 (HNP-1)α-Defensin+4ACYCRIPACIAGERRYGTCIYQGRLWAFCCβ-HairpinNeutrophilPerturbation of cell membrane, ATP efflux and depletion31, 32
LL-37Cathelicidin+6LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESExtended/helixEpidermis, mucosa, neutrophilUnknown for fungi