TABLE 3.

Protein sequence determined by MALDI-MS or N terminal amino acid sequencing

Originally assigned nameProteinAmino acidsaSequence coverage (%)Predicted molecular mass (kDa)
Hbp1Gcf1pATKVATTTTKKTTKKAGDSVAEFYOFPEEEKYVQENYIR1528
Hbp2Nhp6MAPGERKKSSRKKKDPDAPKRSLSAYMFFANENRDIVRAENPGISFGQVGKLLGEKWKALNSEDKLPYENKAEADKKRYEKEKAEYAKKNSA4211
Hbp5Htb1MAPKAEKKPASKAPAEKKPAAKKTATSGTKKRSKTRKETYSSYIYKVLKQTHPDTGISQKAMSIMNSFVNDIFERIAGEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSAAN3214
Hbp6Hta1MSGGKGKAGSSEKASTSRSAKAGLTFPVGRVHRLLRKGNYAQRVGSGAPVYLTSVLEYLAAEILELAGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKSAKGKASQEL1714
  • a The amino acids determined by sequencing are underlined.