| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |
Previous Article | Next Article ![]()
Eukaryotic Cell, December 2005, p. 2087-2097, Vol. 4, No. 12
1535-9778/05/$08.00+0 doi:10.1128/EC.4.12.2087-2097.2005
Copyright © 2005, American Society for Microbiology. All Rights Reserved.
Robert van Lis,
and
Samuel I. Beale*
Division of Biology and Medicine, Brown University, Providence, Rhode Island 02912
Received 10 August 2005/ Accepted 25 September 2005
| ABSTRACT |
|---|
|
|
|---|
| INTRODUCTION |
|---|
|
|
|---|
All hemes are biosynthesized from the precursor
5-aminolevulinic acid (ALA)
(6). In most prokaryotes
and in all photosynthetic algae and plants, ALA is made from glutamate
in a three-step process involving a glutamyl-tRNA synthetase (EC
6.1.1.17
[EC]
), glutamyl-tRNA reductase (EC 1.2.1.70
[EC]
), and
glutamate-1-semialdehyde aminotransferase (GSAT) (EC 5.4.3.8
[EC]
). In
contrast, in animals, yeasts, fungi, and members of the
-proteobacteria, ALA is formed in a single step by
condensation of glycine and succinyl coenzyme A catalyzed by the
pyridoxal phosphate-dependent enzyme ALA synthase (EC 2.3.1.37
[EC]
). To
date, the kinetoplastid Euglena gracilis is the only organism
known to synthesize ALA via both routes
(55). In animal cells,
yeasts, and fungi, ALA synthase is localized in the mitochondria,
whereas in photosynthetic eukaryotes, the enzymes involved in ALA
synthesis from glutamate appear to be located exclusively in the
chloroplast (5).
The biosynthetic steps from ALA to heme are common to nearly all organisms. In animal cells, mitochondrially synthesized ALA is exported to the cytosol, where it is converted to coproporphyrinogen III by a set of four enzymes. Coproporphyrinogen III is then transported to the mitochondria, where the last three steps of heme synthesis take place, namely, conversion of coproporphyrinogen III to protoporphyrinogen IX by coproporphyrinogen III oxidase (EC 1.1.1.3 [EC] ), oxidation of protoporphyrinogen IX to protoporphyrin IX by protoporphyrinogen IX oxidase (PPO) (EC 1.3.3.4 [EC] ), and the insertion of a Fe2+ atom into the macrocyclic ring by ferrochelatase (FeC) (EC 4.99.1.1 [EC] ). In yeasts and fungi, coproporphyrinogen III oxidase is cytoplasmic rather than mitochondrial (26), but the other enzymes are located as in animal cells. In contrast, in photosynthetic eukaryotes, the enzymes involved in the conversion of ALA to protoporphyrinogen IX are detected exclusively in the chloroplast (5). The localization of PPO and FeC is unresolved as yet. In angiosperm plants, PPO is usually encoded by two genes, one of whose products is believed to be targeted specifically to chloroplasts and the other to the mitochondria (28, 54). Plants also generally contain two genes for FeC, but there is a current debate concerning whether the products of these genes are located only in the chloroplasts or whether each isoform is targeted to a different organelle (9, 29, 30). In the unicellular green alga Chlamydomonas reinhardtii, PPO and FeC are each encoded by a single gene (51). Immunoblot analysis of chloroplast and mitochondrial fractions of C. reinhardtii cells indicated that both PPO and FeC are located exclusively in the chloroplast (51). Neither protein was detected in mitochondria isolated from cells grown under photosynthetic conditions. The results imply that heme is exported from the chloroplast for use in other parts of the cell. Heme export from isolated pea chloroplasts has been described previously (48). However, the mechanism of heme export from chloroplasts to the mitochondria and cytoplasm is not understood.
Polytomella sp. is a nonphotosynthetic, motile, unicellular protist that is believed to have evolved from a photosynthetic algal ancestor (16, 41). Polytomella sp. is viewed as a close relative of C. reinhardtii (1, 40, 52). Polytomella sp. cells are wall-less and have plastid-related organelles, known as amyloplasts, that contain starch. Virtually nothing is known about the metabolism of these organelles. Because Polytomella sp. does not contain a functional photosynthetic apparatus but does have active mitochondrial respiratory metabolism, it was of interest to determine which of the two known pathways it uses to synthesize ALA and whether the cells have evolved the ability to synthesize heme in the mitochondria instead of depending on the amyloplasts to synthesize heme for use in the mitochondria. Here we show the occurrence of a GSAT in Polytomella sp., suggesting that the cells use the glutamate route to ALA. Furthermore, analysis of Polytomella sp. GSAT, PPO, and FeC shows that these enzymes are most similar to their counterparts in C. reinhardtii and plants. Immunoblotting results indicate that all three enzymes are enriched in the amyloplasts.
| MATERIALS AND METHODS |
|---|
|
|
|---|
Polytomella sp. cell fractions were obtained as follows. Cells were disrupted with glass beads essentially as described previously (3). Polytomella sp. homogenate was centrifuged at 500 x g for 2 min, yielding a pellet enriched in amyloplasts (P1); the supernatant was centrifuged at 3,000 x g for 10 min, yielding pellet P2; and finally the supernatant was centrifuged at 15,000 x g for 10 min, yielding a pellet enriched in mitochondria (P3). Polytomella sp. cells were fractionated into soluble and membrane components as follows. Cells were harvested and resuspended in HEPES-KOH, 50 mM, pH 7.2, containing 1 mM 6-aminocaproic acid and 0.1 mM phenylmethylsulfonyl fluoride. Cells were sonicated four times for 10 s and centrifuged at 150,000 x g for 1 h. The supernatant, containing the soluble proteins, was removed, and the membrane-containing pellet was resuspended in HEPES-KOH, 50 mM, pH 7.2. The suspension was centrifuged again at 150,000 x g for 1 h, and the pellet was resuspended in HEPES-KOH, 50 mM, pH 7.2, containing 1 mM 6-aminocaproic acid and 0.1 mM phenylmethylsulfonyl fluoride.
Construction of a Polytomella sp. cDNA library and complementation of heme-deficient strains of Escherichia coli.
Total RNA of Polytomella sp.
cells was isolated using an RNeasy kit (QIAGEN, Valencia, CA).
Poly(A)+ RNA was isolated and used for construction
of a cDNA library with a
ZAPII cDNA synthesis kit (Stratagene,
La Jolla, CA).
For complementation, a sample of the library was excised with helper phage VCMS13 in XL1-Blue MRF' E. coli cells (Stratagene) and recovered as pBlueScript plasmids. E. coli GSAT-deficient (hemL) strain GE 1377 (23) was obtained from the E. coli Genetic Stock Center (Yale University, New Haven, CT). E. coli strains deficient in PPO (hemG) (43) and FeC (hemH) (32) were obtained from H. A. Dailey (University of Georgia, Athens, GA). Batches of electrocompetent E. coli hemL cells were transformed with 1 µg of plasmid and selected for ALA-independent growth on LB-ampicillin plates. Batches of electrocompetent E. coli hemH and hemG cells were transformed with 1 µg of plasmid and selected for hemin-independent growth on LB-ampicillin plates. For each transformation, approximately 2 x 108 to 3 x 108 cells were used.
DNA analysis.
Total DNA from Polytomella
sp. was isolated according to Newman et al.
(34). The DNA was
digested with restriction enzymes, separated on a 1% (wt/vol) agarose
gel, and transferred onto Hybond-N+ membranes
(Amersham, Piscataway, NJ) by using standard protocols
(42). An Alkphos direct
labeling and detection system kit (Amersham Pharmacia Biotech) was used
to label the Polytomella sp. GSAT DNA probe, and subsequent
hybridization was carried out following the recommended protocol.
Polytomella sp. PPO and Polytomella sp. FeC DNA
probes were labeled with [
-32P]dCTP by use of a
random primer labeling kit (Gibco BRL, Carlsbad, CA). Membranes were
hybridized overnight at 65°C and washed twice for 20 min at
65°C in 0.2x SSC (1x SSC is 0.15 M NaCl plus
0.015 M sodium citrate) and 0.5% sodium dodecyl sulfate
(SDS).
Construction of expression vectors, overexpression, and antibody production. The region of Polytomella sp. GSAT cDNA (from M36 to A475) was amplified using PCR primers 5'-GACGTCGACTGATGAAGGCTGCATCTAAGC-3'and 5'-GTCCTGCAGGCGTTTGCGGCGGCGCTAATC-3'(the cloning restriction sites are underlined). The region of Polytomella sp. PPO cDNA (from I54 to K577) was amplified using PCR primers 5'-GACCCATGGGAATCTCTGGGTTGTCTACTGCC-3'and 5'-GTCAGATCTTTTTTTTCTCGCCAATTC-3'.The region of Polytomella sp. FeC cDNA (from E61 to S437) was amplified using PCR primers 5'-GACGAGCTCGAGAAGCTGGGTGTGTTC-3'and 5'-GTCCTGCAGGGACCAAAGGTAGGTCGA-3'. The amplified products were ligated into pGEM-T-easy (Promega, Madison, WI).
The product for Polytomella sp. GSAT was digested with SalI and PstI and ligated into expression vector pQE-30 (QIAGEN) predigested with SalI and PstI. The product for Polytomella sp. PPO was digested with BglII and NcoI and ligated into expression vector pQE-60 (QIAGEN) predigested with BglII and NcoI. The product for Polytomella sp. FeC was digested with SacI and PstI and ligated into expression vector pQE-30 (QIAGEN) predigested with SacI and PstI. The resulting plasmids were used to transform E. coli XL1-Blue MRF'.
The pQE-30 and pQE-60 vectors introduced His6 tags at the N- and C-terminal ends of the expressed proteins, respectively. Overexpression of the His-tagged proteins was induced with 1 mM IPTG (isopropyl-ß-D-thiogalactopyranoside). Overexpressed Polytomella sp. GSAT in inclusion bodies was purified on a Ni-nitrilotriacetic acid affinity column, according to the QIAGEN product manual, after denaturation in 8 M urea. The expressed Polytomella sp. PPO and Polytomella sp. FeC proteins were purified on Ni-nitrilotriacetic acid columns under denaturing conditions after cell proteins were denatured in 6 M guanidinium hydrochloride. Antibodies were raised against the purified Polytomella sp. GSAT, Polytomella sp. PPO, and Polytomella sp. FeC proteins in rabbits (Animal Pharm Services, Cloverdale, CA).
Protein analysis.
Resuspended cells
were solubilized in 2% (wt/vol) SDS in the presence of 1 mM
ß-mercaptoethanol and heated at 90°C for 2 min.
Proteins were separated by SDS-polyacrylamide gel electrophoresis
(SDS-PAGE) with a 12% (wt/vol) gel and subsequently transferred onto
nitrocellulose membranes (Schleicher and Schuell, Keene, NH) for
immunodetection. Blots were incubated for 1 h with primary
antibodies at 1:5,000 for anti-Polytomella sp. GSAT and
anti-Polytomella sp. PPO and at 1:2,000 for
anti-Polytomella sp. FeC, anti-Cox2a (obtained from D.
González-Halphen, Autonomous National University of Mexico,
Mexico City), and anti-
-amylase (Sigma-Aldrich, St. Louis, MO)
and then for 1 h with horseradish peroxidase-conjugated
anti-rabbit immunoglobulin G (Pierce, Rockford, IL). Signals were
visualized using an enhanced chemiluminescence system (SuperSignal West
Pico kit; Pierce). A benchmark prestained protein ladder (Invitrogen,
Carlsbad, CA) was used to estimate molecular
masses.
Sequence analysis. Molecular masses and pI values were calculated using Compute pI/MW (18) (available at ExPASy Tools, Swiss Institute of Bioinformatics [http://www.expasy.ch]). Prediction of targeting to mitochondria and chloroplasts was done using TargetP v 1.1 (17, 35) (available at the Center for Biological Sequence Analysis, Technical University of Denmark [http://www.cbs.dtu.dk/services/TargetP/]) and Predotar v. 1.03 (at ExPASy Tools). Prediction of transmembrane segments was performed using HMMTOP, TMHMM, and SOSUI (all at ExPASy Tools). Sequence identity calculations were done using SIM (at ExPASy Tools), with the gap open penalty set at 12 and the gap extension penalty set at 4 (22). Multiple sequence alignments were done using CLUSTALWv. 1.82 (49), and bootstrapped neighbor-joining trees were constructed using CLUSTALX v. 1.83 (50) with standard settings (1,000 trials) and visualized with TreeView v. 1.6.6 (37) (available at http://taxonomy.zoology.gla.ac.uk/rod/treeview.html).
Nucleotide sequence accession numbers. The sequence of Polytomella sp. GSAT cDNA was deposited in GenBank under accession number AY152854, the sequence of Polytomella sp. PPO cDNA under accession number AF332964, and the sequence of Polytomella sp. FeC cDNA under accession number AF332963.
| RESULTS |
|---|
|
|
|---|
Complementation of an E. coli hemL strain,
which lacks GSAT, led to the retrieval of a high number of colonies,
all containing a single type of Polytomella sp. cDNA. The
isolated 1,756-bp cDNA exhibits a 1,440-bp open reading frame (ORF) for
a protein of 480 amino acids with a predicted molecular mass of 50,794
Da. Polytomella sp. GSAT has 80% similarity with C.
reinhardtii GSAT
(31) (GenBank accession
number
Q39566) and
67% similarity with E. coli GSAT (GenBank accession number
P23893).
Compared to bacterial GSAT, cDNA-predicted GSATs of photosynthetic
eukaryotes exhibit an N-terminal extension which serves as a
chloroplast-targeting peptide. Polytomella sp. GSAT also
exhibits a 40-residue extension at its N terminus (Fig.
1A), which appears to be an intracellular targeting sequence. Interestingly,
this extension exhibits typical features of mitochondrial targeting
sequences: a high content of hydroxylated residues and positively
charged residues as well as a potential amphiphilic
-helix
(G16 through A32). The targeting prediction programs Predotar and
TargetP gave higher scores for targeting to chloroplasts than to
mitochondria (Table
1). The most-N-terminal region of the predicted mature Polytomella
sp. GSAT that has high similarity to both eukaryotic and prokaryotic
GSATs begins at residue T46 of the predicted precursor protein. The
invariant active-site Lys occurs at position 181 of the precursor
protein (see Fig. S1 in the supplemental material). The predicted
442-residue mature Polytomella sp. GSAT has a molecular mass
of 46,617 Da and a pI of 7.01. Mature Polytomella sp. GSAT
was predicted to be soluble by the programs HMMTOP,
TMHMM, and SOSUI. Polytomella sp. GSAT has a short
insertion, not present in other GSATs, containing mostly charged
residues (EELGKEVEKK), beginning at residue E407
of the preprotein (see Fig. S1 in the supplemental material). Modeling
based on the X-ray crystallographic structure of GSAT from
Synechococcus sp. PCC 6301
(21) (Protein Data Bank
accession number 2GSA) indicates that the insert lies within a
solvent-exposed loop near the distal apices of the homodimeric protein
(results not shown).
|
|
40%). The identity of Polytomella sp. PPO to
mitochondrial PPOs is significantly lower, ranging between 16% and 28%,
and the identity to E. coli PPO is very low (Table
1). As is found for PPOs
from photosynthetic eukaryotes, Polytomella sp. PPO exhibits
an N-terminal extension compared to prokaryotic PPOs (Fig.
1B). Of note, the
N-terminal extensions in Polytomella sp. and C.
reinhardtii differ in both length and amino acid content. The
targeting prediction programs TargetP and Predotar gave inconclusive
results (Table 1). The
TargetP-predicted presequence (111 residues) includes residues that are
within the region that has significant similarity to both eukaryotic
and prokaryotic PPOs, and therefore it is likely that this predicted
presequence is too long. A plausible mature Polytomella sp.
PPO would begin at residue F41 of the preprotein, which is the
beginning of the most-N-terminal region that has similarity to both
eukaryotic and prokaryotic PPOs. Starting from this residue, the
predicted mature Polytomella sp. PPO has 537 residues, a
molecular mass of 57,635 Da, and a pI of 8.66. Polytomella sp.
PPO contains an invariant GXGXXG motif near the N
terminus (residues 51 through 56 of the preprotein) (Fig.
1B; see also Fig. S2 in
the supplemental material) that has been proposed to be a
dinucleotide-binding motif for binding the flavin adenine dinucleotide
(FAD) cofactor
(12,
13). This proposed
functional assignment has been partially confirmed by the recently
available crystal structure of PPO-II from Nicotiana tabacum,
which indicates that one of these residues, which corresponds to S55 of
the Polytomella sp. PPO preprotein, is hydrogen bonded to the
cofactor (25) (Protein
Data Bank accession number 1SEZ). Polytomella sp. PPO exhibits
an atypical insertion of approximately 28 residues
(RMSHQGDDDSSRTAGAVPRTAEGDVAAG) that
begins at or near residue R326 of the preprotein, which is not present
in other PPOs and is characterized by a high content of charged
residues (see Fig. S2 in the supplemental material). This sequence had
no matches in the GenBank database. Modeling based on the X-ray
crystallographic structure of PPO-II from N. tabacum indicates
that the insert lies within a solvent-exposed loop in the FAD-binding
domain, distal to the homodimer interface and away from the
membrane-binding domain and putative domain for interaction with FeC
(results not shown). Complementation of an E. coli hemH strain, which lacks FeC activity, led to the retrieval of four colonies. The 2,227-bp cDNA for Polytomella sp. FeC exhibits a 1,320-bp ORF encoding a precursor protein of 440 amino acids and a calculated molecular mass of 48,571 Da. Comparison with bacterial FeC sequences indicates that Polytomella sp. FeC has a long N-terminal sequence, likely an intracellular targeting peptide (Fig. 1C). The N-terminal extension of Polytomella sp. FeC shares no obvious features with that of C. reinhardtii FeC. As for Polytomella sp. PPO, the targeting prediction programs TargetP and Predotar gave inconclusive results (Table 1). The most-N-terminal region of the predicted mature Polytomella sp. FeC that has high similarity to both eukaryotic and prokaryotic FeCs begins at residue K5 of the predicted mature protein. The predicted 394-residue mature Polytomella sp. FeC has a molecular mass of 43,584 Da and a pI of 5.76. An invariant active-site His, which is required for activity (56), is located at position 257 of the preprotein (see Fig. S3 in the supplemental material). Polytomella sp. FeC also exhibits a conserved, mostly hydrophobic 46-residue loop, YNLFNDPDIIRMPPVANMFQPIVAKIISSTRASKSAKGYESIGGGS, beginning at residue Y84 of the preprotein, and a 12-residue loop, AYQSRVGPTEWL, beginning at residue A298 of the preprotein. These loops form upper and lower "lips," respectively, at the opening of the active site pocket and are reported to confer membrane association of FeCs (14, 46, 56). The C-terminal portions of FeCs show characteristics specific to certain groups of organisms (11, 14). The FeCs of animals, yeasts, and plants contain a C-terminal extension that is absent from most bacterial FeCs (11). Animal FeCs and those of some yeasts and bacteria are characterized by the presence of a [2Fe-2S] cluster (10, 14). Three of the four Cys ligands required to bind the [2Fe-2S] cluster are found at the C terminus of these FeCs (10). No Cys residues for a [2Fe-2S] cluster are found in FeCs of Saccharomyces cerevisiae or photosynthetic eukaryotes. The C terminus is also involved in the dimerization of FeCs, although some FeCs that contain a C-terminal extension are nonetheless monomeric (14, 56). In many FeCs from photosynthetic organisms, the C terminus exhibits an LHC motif, a consensus sequence of light-harvesting chlorophyll-binding proteins, which could play a role in directing the protein to the thylakoid membranes or anchoring the protein in the membranes (24). The C terminus of Polytomella sp. FeC has an intermediate length, longer than those of FeCs of photosynthetic organisms and shorter than those of FeCs of yeasts and mammals (see Fig. S3 in the supplemental material). Analysis of the C terminus of Polytomella sp. FeC did not reveal the presence of either the LHC motif or the [2Fe-2S] cluster-binding Cys residues (see Fig. S3 in the supplemental material).
Southern hybridizations. To determine the numbers of gene copies for the enzymes of interest, total Polytomella sp. genomic DNA was digested with different restriction enzymes. Southern analysis utilizing DNA probes corresponding to the predicted coding regions of Polytomella sp. GSAT, Polytomella sp. PPO, and Polytomella sp. FeC was carried out under high-stringency hybridization conditions. The hybridization patterns support the presence of one gene each for GSAT, PPO, and FeC in Polytomella sp. (Fig. 2).
|
Anti-Polytomella sp. GSAT
antiserum recognized in Polytomella sp. cell extract a single
protein with an apparent molecular mass of
54 kDa (Fig.
3B), which is somewhat higher than the molecular mass of predicted mature
Polytomella sp. GSAT (
47 kDa). The
anti-Polytomella sp. GSAT antibodies also recognized C.
reinhardtii GSAT as a slightly smaller protein (molecular mass of
48 kDa).
|
65 kDa, larger than the molecular mass
calculated for the predicted mature Polytomella sp. PPO
(
58 kDa) (Fig.
3C). The antibody also
recognized C. reinhardtii PPO as a slightly shorter protein
(
63 kDa), consistent with the fact that Polytomella
sp. PPO contains a 24-residue insertion compared to its counterpart in
C. reinhardtii.
Anti-Polytomella sp. FeC
recognized in cell extract from Polytomella sp. a protein with
an apparent molecular mass of
45 kDa. With
ß-mercaptoethanol in the gel loading buffer, a single band was
detected, whereas in the presence of 50 mM dithiothreitol, an
additional band at
90 kDa was observed (Fig.
3D). It is likely that the
90-kDa form corresponds to a Polytomella sp. FeC homodimer.
However, any role of Cys residues in holding the dimer together is
unlikely to be direct. Modeling based on the X-ray crystallographic
structure of a human FeC
(56) (Protein Data Bank
accession number 1HRK) indicates that the four Cys residues present in
the predicted mature form of Polytomella sp. FeC are spaced
too far apart to form intra- or intersubunit disulfide bonds in the
native enzyme (results not
shown).
Subcellular localization of Polytomella sp. GSAT, PPO, and FeC. Association of Polytomella sp. proteins with total cell membranes was examined. Cells grown on acetate at pH 6.0 were fractionated into their soluble and membrane components after sonication and ultracentrifugation. Cell fractions were loaded on an SDS-PAGE gel and transferred to a nitrocellulose membrane for immunoblotting. To assess the effectiveness of the fractionation, cell fractions were probed with a specific antibody raised against Cox2a, a mitochondrial cytochrome c oxidase subunit which has two transmembrane helices (38). The 15-kDa Cox2a protein was detected only in the membrane fraction (Fig. 4B). GSAT was found mostly in the soluble fraction. In contrast, PPO was found mostly in the membrane fractions and was barely detectable in the soluble fraction. Surprisingly, FeC was distributed between the soluble and membrane fractions, suggesting that the protein is loosely attached to the membranes.
|
-amylase, but the
mitochondrial protein Cox2a was barely detectable in this pellet (Fig.
5B). These results
indicate that this fraction contains amyloplasts and is largely devoid
of mitochondria but that it might contain some unbroken cells. In
contrast, the higher-speed pellets (P2 and P3) showed abundant amounts
of Cox2a but very low amounts of
-amylase, indicating that
these fractions are enriched in mitochondria and largely devoid of
amyloplasts. Immunoblots show that GSAT, PPO, and FeC were all enriched
in the fraction that contained predominantly amyloplasts compared to
the fraction that contained predominantly mitochondria. These results
indicate that all three of these proteins involved in heme biosynthesis
are concentrated in the amyloplasts. However, the results do not rule
out the possibility that the mitochondria might contain minor amounts
of these proteins.
|
| DISCUSSION |
|---|
|
|
|---|
By use
of complementation of E. coli hemL mutants, a single class of
cDNA was isolated. Polytomella sp. cDNA encodes a typical GSAT
which shows high similarity with C. reinhardtii GSAT.
Complementation did not retrieve any clones for an ALA synthase, in
contrast to the results of complementing ALA synthesis-defective E.
coli mutants with
-proteobacterial and human cDNAs
(27,
45). The isolation of
Polytomella sp. cDNA for GSAT, but not for ALA synthase,
indicates that there exists in this colorless alga, as in all
photosynthetic eukaryotes, the five-carbon pathway for ALA synthesis.
Phylogenetic analysis of the available GSAT sequences shows three major
groups: the archaea, the bacteria except the cyanobacteria, and the
cyanobacteria plus photosynthetic eukaryotes. Polytomella sp.
GSAT groups with GSATs of cyanobacteria and photosynthetic eukaryotes
(Fig.
6). It is thus hypothesized that Polytomella sp., which has
apparently evolved from a photosynthetic C. reinhardtii-like
ancestor, has retained the glutamate pathway to synthesize its
hemes.
|
Of the three Polytomella sp. proteins analyzed in this work, PPO is the most divergent from that of C. reinhardtii (Table 1). Nevertheless, PPO phylogenetic analysis showed that Polytomella sp. PPO clusters with the group formed by photosynthetic eukaryotes and cyanobacteria (Fig. 7A). Furthermore, the analysis showed two distinct clusters of PPOs among photosynthetic organisms, which seem to correspond to the two forms of PPO identified to date in plants: PPO-I, a form present in chloroplasts of photosynthetic tissues, and PPO-II, a form that was variously reported to be located in the mitochondria or dually targeted to mitochondria and chloroplasts (28, 54). For C. reinhardtii, a single form of PPO, which was localized to the chloroplast and shown to group with the PPO-I forms expressed in photosynthetic tissues, was identified (51). Polytomella sp. PPO also groups with the photosynthetic tissue form (Fig. 7A). Polytomella sp. PPO was found to be membrane bound, as is the PPO of C. reinhardtii (51) as well as those of plants, animals, and most bacteria (12, 13).
|
The three Polytomella sp. heme
biosynthetic enzymes all exhibit predicted long N-terminal extensions
relative to their prokaryotic counterparts, and these extensions likely
serve as targeting peptides. These targeting sequences are different
from the sequences for mitochondrial and chloroplast targeting in
C. reinhardtii and plants, and predictions based on current
targeting prediction programs are inconclusive. Although a few
mitochondrial presequences are known for Polytomella sp.
(4,
39), no targeting peptide
that serves as an amyloplast targeting sequence has been identified as
yet. The set of experiments carried out in the present work showed a
clear abundance of GSAT, PPO, and FeC in a fraction that is enriched in
starch and
-amylase, but all three proteins were detected,
albeit at lower abundance, in a fraction that is enriched in the
mitochondrial protein Cox2a. This might result from a slight
contamination of mitochondria by amyloplast membranes. Although the
products of GSAT-encoding genes of the nonphotosynthetic algae
Helicosporidium sp. and P. wickerhamii were predicted
on the basis of phylogenetic analysis to be targeted to the plastids,
direct determination of their intracellular locations has not been
reported (7,
15). PPO and FeC have not
been analyzed for these algae.
An obvious function of the amyloplasts in Polytomella sp. is starch synthesis and accumulation, as for the chloroplasts in photosynthetic eukaryotes. Other possible metabolic functions of Polytomella sp. amyloplasts are not well understood. As with all respiring eukaryotes, hemes are required in the Polytomella sp. mitochondrial electron transport chain. Mitochondrial cytochromes in Polytomella sp. have been extensively characterized (1, 2, 19, 38, 39, 52). In contrast, there is no evidence to date for cytochromes or other hemoproteins in the amyloplasts. From the present results, it is inferred that amyloplasts are the major site of heme synthesis in Polytomella sp., thus resembling the chloroplasts of C. reinhardtii and plants. At present, it cannot be concluded whether GSAT, PPO, and FeC are located exclusively in the amyloplasts of Polytomella sp., as they are in the chloroplast of C. reinhardtii (36, 51). Further knowledge about the intracellular localization of Polytomella sp. heme biosynthetic enzymes will benefit from the development of protocols for isolation of pure mitochondria and amyloplasts as well as for in vivo localization of the proteins.
| ACKNOWLEDGMENTS |
|---|
We thank H. A. Dailey for providing E. coli hemG and hemH strains, D. González-Halphen for anti-Cox2a antibody, and L. A. Nogaj for critical comments on the manuscript.
| FOOTNOTES |
|---|
Supplemental material for this article may be found at http://ec.asm.org/. ![]()
Present address: Physiologie Cellulaire Végétale, UMR5168 CEA
Grenoble, 17 rue des Martyrs, Grenoble cedex 9, 38054, France. ![]()
| REFERENCES |
|---|
|
|
|---|
2-dimeric
vitamin B6-dependent enzyme with asymmetry in structure and
active site reactivity. Proc. Natl. Acad. Sci. USA
94:4866-4871.
-aminolevulinic acid synthetase from Rhizobium
meliloti. J. Biol. Chem.
257:8724-8730.
-aminolevulinate synthase encoded by the parasite gene in
de novo haem synthesis by Plasmodium falciparum.Biochem. J.
367:32